PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID GRMZM2G156621_P01
Common NameLOC100191346, LOC103626907, SBP12
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; PACMAD clade; Panicoideae; Andropogonodae; Andropogoneae; Tripsacinae; Zea
Family SBP
Protein Properties Length: 332aa    MW: 36514.7 Da    PI: 8.8241
Description SBP family protein
Gene Model
Gene Model ID Type Source Coding Sequence
GRMZM2G156621_P01genomeMaizeSequenceView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1SBP130.94.5e-4158135178
                        --SSTT-----TT--HHHHHTT--HHHHT-S-EEETTEEEEE-TTTSSEEETTT--SS--S-STTTT-------S--- CS
                SBP   1 lCqvegCeadlseakeyhrrhkvCevhskapvvlvsgleqrfCqqCsrfhelsefDeekrsCrrrLakhnerrrkkqa 78 
                        +CqvegC  dls++k+yhr+h+vCe+h+k+p v+v+g+e+rfCqqCsrfh+lsefD++krsCrrrL++hn+rrrk+q+
  GRMZM2G156621_P01  58 RCQVEGCGLDLSRVKDYHRKHRVCEAHTKSPRVIVAGQERRFCQQCSRFHALSEFDQKKRSCRRRLSDHNARRRKPQP 135
                        6**************************************************************************997 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:4.10.1100.101.8E-3353120IPR004333Transcription factor, SBP-box
PROSITE profilePS5114132.42856133IPR004333Transcription factor, SBP-box
SuperFamilySSF1036123.01E-3957138IPR004333Transcription factor, SBP-box
PfamPF031102.4E-3159132IPR004333Transcription factor, SBP-box
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 332 aa     Download sequence    Send to blast
MEWTAPKPAS SPPLLWDWGD HAATGSGSSS DAPARRGGKE REAKRARAGE DRGGGELRCQ  60
VEGCGLDLSR VKDYHRKHRV CEAHTKSPRV IVAGQERRFC QQCSRFHALS EFDQKKRSCR  120
RRLSDHNARR RKPQPDAFTF ASAKLPSTLF DDRRQISFVW NKAPVSHVRP FTSPWDSSSD  180
LKPPYAKEIS DVSTKVGTIT GQVHLDKSHM FNAIPTLSHG KDEPWPMKGL DMSISASKFD  240
GAADLQHALS LLSAGACGLP DSVHQTSCII QFNGASENSS DLHVTHGRNS GPASCADAQH  300
IAAQPQSQLF HFTTDTGNTV YEPSFFGVNQ IN
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1ul4_A2e-25591321184squamosa promoter binding protein-like 4
Search in ModeBase
Nucleic Localization Signal ? help Back to Top
NLS
No. Start End Sequence
1114131KKRSCRRRLSDHNARRRK
Expression -- UniGene ? help Back to Top
UniGene ID E-value Expressed in
Zm.989110.0ear| meristem
Expression -- Microarray ? help Back to Top
Source ID
Expression AtlasGRMZM2G156621
Cis-element ? help Back to Top
SourceLink
PlantRegMapGRMZM2G156621_P01
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankBT0334150.0BT033415.1 Zea mays full-length cDNA clone ZM_BFb0223G18 mRNA, complete cds.
GenBankBT0875080.0BT087508.1 Zea mays full-length cDNA clone ZM_BFb0098L17 mRNA, complete cds.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqNP_001130252.10.0SBP transcription factor
RefseqXP_008645477.10.0PREDICTED: squamosa promoter-binding-like protein 4
SwissprotQ653Z51e-97SPL11_ORYSJ; Squamosa promoter-binding-like protein 11
TrEMBLB4F8H70.0B4F8H7_MAIZE; SBP transcription factor
STRINGGRMZM2G156621_P010.0(Zea mays)
STRINGGRMZM2G126827_P010.0(Zea mays)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP62712952
Representative plantOGRP9717230
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G43270.34e-45squamosa promoter binding protein-like 2